Sequence|UVic PeptideTracker

UniProtKB Accession Start End Peptide Sequence
P12682 166 172 GKPDAAK
FASTA

>sp|P12682|HMGB1_PIG High mobility group protein B1 OS=Sus scrofa OX=9823 GN=HMGB1 PE=2 SV=3
             
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKHPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE
              

    Data source:UniProt