Sequence|UVic PeptideTracker

UniProtKB Accession Start End Peptide Sequence
P53027 8 15 DTLYEAVR
FASTA

>sp|P53027|RL10A_PIG Large ribosomal subunit protein uL1 (Fragment) OS=Sus scrofa OX=9823 GN=RPL10A PE=2 SV=3
             
MSSKVSRDTLYEAVREVLHGNQRNXXKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCXLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNXDMVAKVDEVKSRVKFQMKEVLCL
              

    Data source:UniProt