Sequence|UVic PeptideTracker

UniProtKB Accession Start End Peptide Sequence
Q71LE2 29 41 SAPSTGGVKKPHR
FASTA

>sp|Q71LE2|H33_PIG Histone H3.3 OS=Sus scrofa OX=9823 GN=H3F3A PE=2 SV=3
             
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
              

    Data source:UniProt